PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA394G00001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family B3
Protein Properties Length: 391aa    MW: 45333.4 Da    PI: 10.5341
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA394G00001genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B352.21.1e-1614901195
                 HHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
           B3 11 lksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                 + + +l++pk f+ +h +g   ++kt++l++  s  +W+vk+  ++++    l+ GW eF+ a++Lk gD++vF+++++ +f  +v+
  AA394G00001 14 F-HTQLMIPKAFFLKHiKG-RYKQKTVKLRSdASKVTWRVKI--DGRR----LSYGWDEFCVAHDLKIGDIIVFRHEKDLCF--HVT 90
                 4.456***********733.356789***9978889******..9998....899********************9887777..665 PP

2B365.39.1e-21128216695
                  ..-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
           B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                  ++ ++l+ ++l++p  f++e+g++ke+ k+++l+  +s+++W++ l+ +k  +++++++GW++F++ ngLk+ D+++Fkl++r +++lv++
  AA394G00001 128 ITTSSLRYDMLYFPQGFVRENGINKERFKEIVLMGeQSSKTWNFALR-QKICKTFYIRRGWRSFCSFNGLKVEDSFTFKLTKR-GTTLVLR 216
                  567889999**************************5566*******4.555566*************************9874.4445555 PP

3B358.11.6e-18299388899
                  -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  + v++s+   lp +fa+++++k  e+++++l d++g +W+  l+ + ++ r  + +GWk+F++ang+k+g+++ ++l+++++++ v+++++k
  AA394G00001 299 KPVFESCVQALPIRFARANDIK--EGTQMSLLDKHGVKWSTDLRSQTNGPRLRMVGGWKGFCHANGVKTGESFKLELVWEENTTAVLRFCSK 388
                  789999*99**********988..5668***************888888889999*************************999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.4E-22397IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.716395IPR003340B3 DNA binding domain
SuperFamilySSF1019363.73E-213101IPR015300DNA-binding pseudobarrel domain
CDDcd100172.33E-16592No hitNo description
SMARTSM010194.0E-24695IPR003340B3 DNA binding domain
PfamPF023628.7E-121587IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.9E-18120217IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.31E-16121217IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.634123220IPR003340B3 DNA binding domain
SMARTSM010193.5E-19124221IPR003340B3 DNA binding domain
CDDcd100177.54E-14127217No hitNo description
PfamPF023622.1E-19128216IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.8E-16266388IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.407292388IPR003340B3 DNA binding domain
CDDcd100175.96E-14296386No hitNo description
SuperFamilySSF1019366.08E-17297387IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.6E-17297389IPR003340B3 DNA binding domain
PfamPF023621.6E-17299388IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MANQHFFKPL LPGFHTQLMI PKAFFLKHIK GRYKQKTVKL RSDASKVTWR VKIDGRRLSY  60
GWDEFCVAHD LKIGDIIVFR HEKDLCFHVT PFGPSCCEIQ YTNNHLGKKN PRRETDTPLD  120
HSHLVGKITT SSLRYDMLYF PQGFVRENGI NKERFKEIVL MGEQSSKTWN FALRQKICKT  180
FYIRRGWRSF CSFNGLKVED SFTFKLTKRG TTLVLRLSQT IPEEDDRESR VMSLSTESGS  240
DEERISKESL GGKVNMGRVQ WRASSSPTQN RFLTLNLRPL YVKRHFLCTK FFNSPKILKP  300
VFESCVQALP IRFARANDIK EGTQMSLLDK HGVKWSTDLR SQTNGPRLRM VGGWKGFCHA  360
NGVKTGESFK LELVWEENTT AVLRFCSKVK L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294430.11e-119hypothetical protein CARUB_v10023444mg, partial
TrEMBLR0HTE71e-119R0HTE7_9BRAS; Uncharacterized protein (Fragment)
STRINGBra032078.1-P1e-115(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.11e-102B3 family protein